PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03169g06001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ARF
Protein Properties Length: 740aa    MW: 80509.7 Da    PI: 7.9408
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03169g06001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.43.2e-24157258199
                               EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT- CS
                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegD 78 
                               f+k+lt sd++++g +++p++ ae++       +  ++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD
  Niben101Scf03169g06001.1 157 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyrQ--QRPSQELVAKDLHGIKWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGD 239
                               99****************************9743..345679******************************************* PP

                               EEEEEE-SSSEE..EEEEE-S CS
                        B3  79 fvvFkldgrsefelvvkvfrk 99 
                                v+F   ++ ++el+++v+r+
  Niben101Scf03169g06001.1 240 AVLFL--RTADGELRLGVRRA 258
                               *****..4589999**99986 PP

2Auxin_resp112.63.8e-37283364182
                Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                               +++a+s++++F+++YnPr s+s F+ +++k++k+l +++s+GmRfkm++eted++e+r++G+vvgvsd+dpvrWp+SkWr+L
  Niben101Scf03169g06001.1 283 VVNAISSTNAFSICYNPRGSSSGFILPYHKFSKTLAHPFSAGMRFKMRVETEDAAEQRFTGLVVGVSDVDPVRWPGSKWRCL 364
                               6899*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.36E-42151263IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.8E-40151261IPR015300DNA-binding pseudobarrel domain
CDDcd100177.50E-22155257No hitNo description
SMARTSM010195.2E-22157259IPR003340B3 DNA binding domain
PfamPF023624.6E-22157258IPR003340B3 DNA binding domain
PROSITE profilePS5086313.31157259IPR003340B3 DNA binding domain
PfamPF065079.4E-32284364IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MMCGLIDLNT VDNDDVGEET TTAPVSPASS STASGCSDLT SSSLPAVASV CLELWHACAG  60
PLISLPKKGS AVVYLPQGHL EHLSEYPPIA YNLPPHVFCR VVDVKLQADA ASDEVYAQVS  120
LVPDNQIEQK WRDGDIDSDT EEEEIEGAGK STTPHMFCKT LTASDTSTHG GFSVPRRAAE  180
DCFPPLDYRQ QRPSQELVAK DLHGIKWKFR HIYRGQPRRH LLTTGWSAFV NKKKLVSGDA  240
VLFLRTADGE LRLGVRRAAQ AKTCSNFLAA YSQLLNVSGI VDVVNAISST NAFSICYNPR  300
GSSSGFILPY HKFSKTLAHP FSAGMRFKMR VETEDAAEQR FTGLVVGVSD VDPVRWPGSK  360
WRCLLVRWDD LDICRHNRVS PWEIEPSGSA SVSSSLVMPS AKRTRVGFPI TKADFPIPRD  420
GIAVSDFGES SRFQKVLQGQ EILGINSPYG GFDAHSPRTG GIKCFPGFPS SGTSRMGNNI  480
RTLLGDTDKS PESIGFSDYS GFNKVLQGQE TFSTPRNGRG HASSLMQEKS RTGIIVGIQV  540
PSHVNRWSAP NQGNRSHCNP NTLVPASSPP SVLSFQHPRS PVSKFQAMFN HKHGKLETAT  600
QALDMSESCS RHLASGSHAE DISRKGDTQG ISSFSFLKEQ KQTGISHLSL GTQSSQNLVS  660
MCKTSCRIFG FPLTENKLNA TRAENPAEAV YSRGLETTFL PSTDGKLQPG PPLMTNVVGT  720
NFTKVNDLYA ARDVLLDIAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-1084939318361Auxin response factor 1
4ldy_B1e-1084939318361Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799485.10.0PREDICTED: auxin response factor 3
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLM1D4H80.0M1D4H8_SOLTU; Auxin response factor
STRINGPGSC0003DMT4000812820.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61012333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-179ARF family protein